DYNLL1 antibody (70R-2573)

Rabbit polyclonal DYNLL1 antibody raised against the N terminal of DYNLL1

Synonyms Polyclonal DYNLL1 antibody, Anti-DYNLL1 antibody, LC8 antibody, DLC1 antibody, Dynein Light Chain Lc8-Type 1 antibody, hdlc1 antibody, MGC126138 antibody, DNCL1 antibody, MGC126137 antibody, PIN antibody, DNCLC1 antibody, LC8a antibody, DLC8 antibody
Specificity DYNLL1 antibody was raised against the N terminal of DYNLL1
Cross Reactivity Human,Mouse,Rat,Drosophila
Applications WB
Immunogen DYNLL1 antibody was raised using the N terminal of DYNLL1 corresponding to a region with amino acids MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY
Assay Information DYNLL1 Blocking Peptide, catalog no. 33R-5809, is also available for use as a blocking control in assays to test for specificity of this DYNLL1 antibody


Western blot analysis using DYNLL1 antibody (70R-2573)

Recommended DYNLL1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 10 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DYNLL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kDa. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. DYNLL1 is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using DYNLL1 antibody (70R-2573) | Recommended DYNLL1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors