DYNLL2 Blocking Peptide (33R-6410)
A synthetic peptide for use as a blocking control in assays to test for specificity of DYNLL2 antibody, catalog no. 70R-2312
Overview
Overview
| Synonyms | DYNLL2 control peptide, DYNLL2 antibody Blocking Peptide, Anti-DYNLL2 Blocking Peptide, Dynein Light Chain Lc8-Type 2 Blocking Peptide, DNCL1B Blocking Peptide, Dlc2 Blocking Peptide, MGC17810 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY |
|---|---|
| Molecular Weight | 10 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | DYNLL2 belongs to the dynein light chain family. DYNLL2 may be involved in some aspects of dynein-related intracellular transport and motility. It may play a role in changing or maintaining the spatial distribution of cytoskeletal structures. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product