DYNLL2 Blocking Peptide (33R-6410)

A synthetic peptide for use as a blocking control in assays to test for specificity of DYNLL2 antibody, catalog no. 70R-2312

Synonyms DYNLL2 control peptide, DYNLL2 antibody Blocking Peptide, Anti-DYNLL2 Blocking Peptide, Dynein Light Chain Lc8-Type 2 Blocking Peptide, DNCL1B Blocking Peptide, Dlc2 Blocking Peptide, MGC17810 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY
Molecular Weight 10 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DYNLL2 belongs to the dynein light chain family. DYNLL2 may be involved in some aspects of dynein-related intracellular transport and motility. It may play a role in changing or maintaining the spatial distribution of cytoskeletal structures.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors