DYX1C1 antibody (70R-3214)

Rabbit polyclonal DYX1C1 antibody raised against the C terminal of DYX1C1

Synonyms Polyclonal DYX1C1 antibody, Anti-DYX1C1 antibody, DYX1 antibody, MGC70618 antibody, Dyslexia Susceptibility 1 Candidate 1 antibody, RD antibody, EKN1 antibody, FLJ37882 antibody, DYXC1 antibody
Specificity DYX1C1 antibody was raised against the C terminal of DYX1C1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DYX1C1 antibody was raised using the C terminal of DYX1C1 corresponding to a region with amino acids FATENYLAAINAYNLAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKA
Assay Information DYX1C1 Blocking Peptide, catalog no. 33R-2849, is also available for use as a blocking control in assays to test for specificity of this DYX1C1 antibody


Western Blot analysis using DYX1C1 antibody (70R-3214)

DYX1C1 antibody (70R-3214) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DYX1C1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DYX1C1contains 1 CS domain and 3 TPR repeats. A chromosomal aberration, translocation t(2;15)(q11;q21), involving DYX1C1 may be a cause of dyslexia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DYX1C1 antibody (70R-3214) | DYX1C1 antibody (70R-3214) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors