EARS2 antibody (70R-3329)

Rabbit polyclonal EARS2 antibody

Synonyms Polyclonal EARS2 antibody, Anti-EARS2 antibody, EARS-2, EARS 2 antibody, KIAA1970 antibody, EARS2, EARS 2, MSE1 antibody, EARS-2 antibody, Glutamyl-tRNA Synthetase 2 Mitochondrial antibody
Cross Reactivity Human
Applications WB
Immunogen EARS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL
Assay Information EARS2 Blocking Peptide, catalog no. 33R-8975, is also available for use as a blocking control in assays to test for specificity of this EARS2 antibody


Western Blot analysis using EARS2 antibody (70R-3329)

EARS2 antibody (70R-3329) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EARS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EARS2 belongs to the class-I aminoacyl-tRNA synthetase family. The function of the EARS2 protein is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EARS2 antibody (70R-3329) | EARS2 antibody (70R-3329) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors