EARS2 Blocking Peptide (33R-8975)
A synthetic peptide for use as a blocking control in assays to test for specificity of EARS2 antibody, catalog no. 70R-3329
Overview
Overview
| Synonyms | EARS2 control peptide, EARS2 antibody Blocking Peptide, Anti-EARS2 Blocking Peptide, Glutamyl-tRNA Synthetase 2 Mitochondrial Blocking Peptide, KIAA1970 Blocking Peptide, MSE1 Blocking Peptide, EARS2, EARS-2, EARS 2, EARS-2 Blocking Peptide, EARS 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL |
|---|---|
| Molecular Weight | 59 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | EARS2 belongs to the class-I aminoacyl-tRNA synthetase family. The function of the EARS2 protein is not known. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product