EARS2 Blocking Peptide (33R-8975)

A synthetic peptide for use as a blocking control in assays to test for specificity of EARS2 antibody, catalog no. 70R-3329

Synonyms EARS2 control peptide, EARS2 antibody Blocking Peptide, Anti-EARS2 Blocking Peptide, Glutamyl-tRNA Synthetase 2 Mitochondrial Blocking Peptide, KIAA1970 Blocking Peptide, MSE1 Blocking Peptide, EARS2, EARS-2, EARS 2, EARS-2 Blocking Peptide, EARS 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL
Molecular Weight 59 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EARS2 belongs to the class-I aminoacyl-tRNA synthetase family. The function of the EARS2 protein is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors