EBP Blocking Peptide (33R-5513)

A synthetic peptide for use as a blocking control in assays to test for specificity of EBP antibody, catalog no. 70R-6689

Synonyms EBP control peptide, EBP antibody Blocking Peptide, Anti-EBP Blocking Peptide, Emopamil Binding Protein Blocking Peptide, Sterol Isomerase Blocking Peptide, CDPX2 Blocking Peptide, CHO2 Blocking Peptide, CPX Blocking Peptide, CPXD Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA
Molecular Weight 26 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EBP is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors