EBP Blocking Peptide (33R-5513)
A synthetic peptide for use as a blocking control in assays to test for specificity of EBP antibody, catalog no. 70R-6689
Overview
Overview
| Synonyms | EBP control peptide, EBP antibody Blocking Peptide, Anti-EBP Blocking Peptide, Emopamil Binding Protein Blocking Peptide, Sterol Isomerase Blocking Peptide, CDPX2 Blocking Peptide, CHO2 Blocking Peptide, CPX Blocking Peptide, CPXD Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA |
|---|---|
| Molecular Weight | 26 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | EBP is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product