EDG8 antibody (70R-1766)

Rabbit polyclonal EDG8 antibody raised against the N terminal of EDG8

Synonyms Polyclonal EDG8 antibody, Anti-EDG8 antibody, EDG-8, EDG-8 antibody, SPPR-2 antibody, SPPR-1 antibody, S1P5 antibody, EDG 8, EDG8, EDG 8 antibody, Endothelial Differentiation Sphingolipid G-Protein-Coupled Receptor 8 antibody, Edg-8 antibody, S1PR5 antibody
Specificity EDG8 antibody was raised against the N terminal of EDG8
Cross Reactivity Human, Mouse, Rat, Dog, Drosophila, ZebraFish
Applications IHC, WB
Immunogen EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI
Assay Information EDG8 Blocking Peptide, catalog no. 33R-5958, is also available for use as a blocking control in assays to test for specificity of this EDG8 antibody

Images

Western Blot analysis using EDG8 antibody (70R-1766)

EDG8 antibody (70R-1766) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EDG8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EDG8 antibody (70R-1766) | EDG8 antibody (70R-1766) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors