EDIL3 Blocking Peptide (33R-2651)

A synthetic peptide for use as a blocking control in assays to test for specificity of EDIL3 antibody, catalog no. 70R-9143

Synonyms EDIL3 control peptide, EDIL3 antibody Blocking Peptide, Anti-EDIL3 Blocking Peptide, EGF-like repeats and discoidin I-like domains 3 Blocking Peptide, DEL1 Blocking Peptide, MGC26287 Blocking Peptide, EDIL3, EDIL-3, EDIL 3, EDIL-3 Blocking Peptide, EDIL 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues EPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI
Molecular Weight 54 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors