EDIL3 Blocking Peptide (33R-2651)
A synthetic peptide for use as a blocking control in assays to test for specificity of EDIL3 antibody, catalog no. 70R-9143
Overview
Overview
| Synonyms | EDIL3 control peptide, EDIL3 antibody Blocking Peptide, Anti-EDIL3 Blocking Peptide, EGF-like repeats and discoidin I-like domains 3 Blocking Peptide, DEL1 Blocking Peptide, MGC26287 Blocking Peptide, EDIL3, EDIL-3, EDIL 3, EDIL-3 Blocking Peptide, EDIL 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | EPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI |
|---|---|
| Molecular Weight | 54 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product