EEF1G antibody (70R-1200)

Rabbit polyclonal EEF1G antibody raised against the N terminal of EEF1G

Synonyms Polyclonal EEF1G antibody, Anti-EEF1G antibody, EF1G antibody, Eukaryotic Translation Elongation Factor 1 Gamma antibody, GIG35 antibody
Specificity EEF1G antibody was raised against the N terminal of EEF1G
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EEF1G antibody was raised using the N terminal of EEF1G corresponding to a region with amino acids AAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF
Assay Information EEF1G Blocking Peptide, catalog no. 33R-1044, is also available for use as a blocking control in assays to test for specificity of this EEF1G antibody


Western Blot analysis using EEF1G antibody (70R-1200)

EEF1G antibody (70R-1200) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EEF1G antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EEF1G is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EEF1G antibody (70R-1200) | EEF1G antibody (70R-1200) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors