EEF1G Blocking Peptide (33R-1044)

A synthetic peptide for use as a blocking control in assays to test for specificity of EEF1G antibody, catalog no. 70R-1200

Synonyms EEF1G control peptide, EEF1G antibody Blocking Peptide, Anti-EEF1G Blocking Peptide, Eukaryotic Translation Elongation Factor 1 Gamma Blocking Peptide, EF1G Blocking Peptide, GIG35 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF
Molecular Weight 50 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EEF1G is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors