EEF1G Blocking Peptide (33R-1044)
A synthetic peptide for use as a blocking control in assays to test for specificity of EEF1G antibody, catalog no. 70R-1200
Overview
Overview
| Synonyms | EEF1G control peptide, EEF1G antibody Blocking Peptide, Anti-EEF1G Blocking Peptide, Eukaryotic Translation Elongation Factor 1 Gamma Blocking Peptide, EF1G Blocking Peptide, GIG35 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF |
|---|---|
| Molecular Weight | 50 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | EEF1G is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product