EFCAB4B antibody (70R-3152)

Rabbit polyclonal EFCAB4B antibody raised against the middle region of EFCAB4B

Synonyms Polyclonal EFCAB4B antibody, Anti-EFCAB4B antibody, FLJ33805 antibody, MGC4266 antibody, Ef-Hand Calcium Binding Domain 4B antibody
Specificity EFCAB4B antibody was raised against the middle region of EFCAB4B
Cross Reactivity Human
Applications WB
Immunogen EFCAB4B antibody was raised using the middle region of EFCAB4B corresponding to a region with amino acids KNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLKDTERFQARSQ
Assay Information EFCAB4B Blocking Peptide, catalog no. 33R-4566, is also available for use as a blocking control in assays to test for specificity of this EFCAB4B antibody

Images

Western Blot analysis using EFCAB4B antibody (70R-3152)

EFCAB4B antibody (70R-3152) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EFCAB4B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EFCAB4B is a Ca(2+)-binding protein that plays a key role in store-operated Ca(2+) entry (SOCE) in T-cells by regulating CRAC channel activation. It acts as a cytoplasmic calcium-sensor that facilitates the clustering of ORAI1 and STIM1 at the junctional regions between the plasma membrane and the endoplasmic reticulum upon low Ca(2+) concentration. It thereby regulates CRAC channel activation, including translocation and clustering of ORAI1 and STIM1. Upon increase of cytoplasmic Ca(2+) resulting from opening of CRAC channels, dissociates from ORAI1 and STIM1, thereby destabilizing the ORAI1-STIM1 complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EFCAB4B antibody (70R-3152) | EFCAB4B antibody (70R-3152) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors