EGLN2 Blocking Peptide (33R-5815)

A synthetic peptide for use as a blocking control in assays to test for specificity of EGLN2 antibody, catalog no. 70R-8051

Synonyms EGLN2 control peptide, EGLN2 antibody Blocking Peptide, Anti-EGLN2 Blocking Peptide, egl nine homolog 2, C. elegans Blocking Peptide, EGLN2, EGLN-2, EGLN 2, EGLN-2 Blocking Peptide, EGLN 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MCLPSPSKPTSLHPCQAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLN
Molecular Weight 16 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The hypoxia inducible factor (HIF) is a transcriptional complex which is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. EGLN2 encodes an enzyme responsible for this posttranslational modification. Alternative splicing of EGLN2 results in three transcript variants encoding different isoforms.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors