EGLN2 Blocking Peptide (33R-5815)
A synthetic peptide for use as a blocking control in assays to test for specificity of EGLN2 antibody, catalog no. 70R-8051
Overview
Overview
| Synonyms | EGLN2 control peptide, EGLN2 antibody Blocking Peptide, Anti-EGLN2 Blocking Peptide, egl nine homolog 2, C. elegans Blocking Peptide, EGLN2, EGLN-2, EGLN 2, EGLN-2 Blocking Peptide, EGLN 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MCLPSPSKPTSLHPCQAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLN |
|---|---|
| Molecular Weight | 16 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The hypoxia inducible factor (HIF) is a transcriptional complex which is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. EGLN2 encodes an enzyme responsible for this posttranslational modification. Alternative splicing of EGLN2 results in three transcript variants encoding different isoforms. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product