EGR1 antibody (70R-2040)

Rabbit polyclonal EGR1 antibody raised against the middle region of EGR1

Synonyms Polyclonal EGR1 antibody, Anti-EGR1 antibody, ZIF-268 antibody, Early Growth Response 1 antibody, ZNF225 antibody, AT225 antibody, G0S30 antibody, NGFI-A antibody, KROX-24 antibody, TIS8 antibody
Specificity EGR1 antibody was raised against the middle region of EGR1
Cross Reactivity Human
Applications WB
Immunogen EGR1 antibody was raised using the middle region of EGR1 corresponding to a region with amino acids PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS
Assay Information EGR1 Blocking Peptide, catalog no. 33R-7362, is also available for use as a blocking control in assays to test for specificity of this EGR1 antibody


Western blot analysis using EGR1 antibody (70R-2040)

Recommended EGR1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EGR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using EGR1 antibody (70R-2040) | Recommended EGR1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors