EHD4 antibody (70R-2681)

Rabbit polyclonal EHD4 antibody raised against the middle region of EHD4

Synonyms Polyclonal EHD4 antibody, Anti-EHD4 antibody, PAST4 antibody, Eh-Domain Containing 4 antibody
Specificity EHD4 antibody was raised against the middle region of EHD4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA
Assay Information EHD4 Blocking Peptide, catalog no. 33R-5209, is also available for use as a blocking control in assays to test for specificity of this EHD4 antibody


Immunohistochemical staining using EHD4 antibody (70R-2681)

EHD4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EHD4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using EHD4 antibody (70R-2681) | EHD4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using EHD4 antibody (70R-2681) | EHD4 antibody (70R-2681) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors