EIF2S3 antibody (70R-1058)

Rabbit polyclonal EIF2S3 antibody raised against the N terminal of EIF2S3

Synonyms Polyclonal EIF2S3 antibody, Anti-EIF2S3 antibody, EIF2G antibody, EIFS3 2, EIF2gamma antibody, EIF2S3, Eukaryotic Translation Initiation Factor 2 Subunit 3 Gamma 52Kda antibody, EIF2 antibody, EIFS3 2 antibody, EIFS3-2, EIFS3-2 antibody
Specificity EIF2S3 antibody was raised against the N terminal of EIF2S3
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen EIF2S3 antibody was raised using the N terminal of EIF2S3 corresponding to a region with amino acids LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI
Assay Information EIF2S3 Blocking Peptide, catalog no. 33R-4841, is also available for use as a blocking control in assays to test for specificity of this EIF2S3 antibody

Images

Western Blot analysis using EIF2S3 antibody (70R-1058)

EIF2S3 antibody (70R-1058) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EIF2S3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EIF2S3 antibody (70R-1058) | EIF2S3 antibody (70R-1058) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors