EIF3E antibody (70R-3592)

Rabbit polyclonal EIF3E antibody raised against the middle region of EIF3E

Synonyms Polyclonal EIF3E antibody, Anti-EIF3E antibody, EIFE 3, EIF3E, EIF3-P48 antibody, EIFE-3, EIF3S6 antibody, EIFE 3 antibody, EIFE-3 antibody, Eukaryotic Translation Initiation Factor 3 Subunit E antibody, INT6 antibody, eIF3-p46 antibody
Specificity EIF3E antibody was raised against the middle region of EIF3E
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EIF3E antibody was raised using the middle region of EIF3E corresponding to a region with amino acids LNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTK
Assay Information EIF3E Blocking Peptide, catalog no. 33R-5232, is also available for use as a blocking control in assays to test for specificity of this EIF3E antibody

Images

Western Blot analysis using EIF3E antibody (70R-3592)

EIF3E antibody (70R-3592) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF3E antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD); It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EIF3E antibody (70R-3592) | EIF3E antibody (70R-3592) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors