EIF3EIP antibody (70R-4419)

Rabbit polyclonal EIF3EIP antibody raised against the N terminal of EIF3EIP

Synonyms Polyclonal EIF3EIP antibody, Anti-EIF3EIP antibody, EIFEIP-3 antibody, EIFEIP 3, HSPC021 antibody, MSTP005 antibody, EIF3S11 antibody, Eukaryotic Translation Initiation Factor 3 Subunit E Interacting Protein antibody, EIF3S6IP antibody, EIFEIP-3, HSPC025 antibody, EIF3EIP, EIFEIP 3 antibody
Specificity EIF3EIP antibody was raised against the N terminal of EIF3EIP
Cross Reactivity Human,Mouse
Applications WB
Immunogen EIF3EIP antibody was raised using the N terminal of EIF3EIP corresponding to a region with amino acids SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEV
Assay Information EIF3EIP Blocking Peptide, catalog no. 33R-8952, is also available for use as a blocking control in assays to test for specificity of this EIF3EIP antibody


Western Blot analysis using EIF3EIP antibody (70R-4419)

EIF3EIP antibody (70R-4419) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF3EIP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF3EIP belongs to the EIF3EIP family. It interacts with EIF3E. EIF3EIP interacts with Int-6 and is associated with eukaryotic translation initiation factor 3.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EIF3EIP antibody (70R-4419) | EIF3EIP antibody (70R-4419) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors