EIF4B antibody (70R-4927)

Rabbit polyclonal EIF4B antibody raised against the middle region of EIF4B

Synonyms Polyclonal EIF4B antibody, Anti-EIF4B antibody, EIF-4B antibody, Eukaryotic Translation Initiation Factor 4B antibody, EIFB-4 antibody, EIFB-4, PRO1843 antibody, EIF4B, EIFB 4, EIFB 4 antibody
Specificity EIF4B antibody was raised against the middle region of EIF4B
Cross Reactivity Human
Applications WB
Immunogen EIF4B antibody was raised using the middle region of EIF4B corresponding to a region with amino acids QTGNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFS
Assay Information EIF4B Blocking Peptide, catalog no. 33R-7750, is also available for use as a blocking control in assays to test for specificity of this EIF4B antibody

Images

Western Blot analysis using EIF4B antibody (70R-4927)

EIF4B antibody (70R-4927) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF4B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IF4B contains 1 RRM (RNA recognition motif) domain and is required for the binding of mRNA to ribosomes. Functions of EIF4B are in close association with EEF4-F and EIF4-A. It binds near the 5'-terminal cap of mRNA in presence of EIF-4F and ATP and promotes the ATPase activity and the ATP-dependent RNA unwinding activity of both EIF4-A and EIF4-F.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EIF4B antibody (70R-4927) | EIF4B antibody (70R-4927) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors