EIF4E2 antibody (70R-1416)

Rabbit polyclonal EIF4E2 antibody raised against the N terminal of EIF4E2

Synonyms Polyclonal EIF4E2 antibody, Anti-EIF4E2 antibody, EIF4E2, EIF4E2 400, EIF4E2 400 antibody, EIF4E2-400, Eukaryotic Translation Initiation Factor 4E Family Member 2 antibody, EIF4E2-400 antibody
Specificity EIF4E2 antibody was raised against the N terminal of EIF4E2
Cross Reactivity Human
Applications IHC, WB
Immunogen EIF4E2 antibody was raised using the N terminal of EIF4E2 corresponding to a region with amino acids KDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQY
Assay Information EIF4E2 Blocking Peptide, catalog no. 33R-4279, is also available for use as a blocking control in assays to test for specificity of this EIF4E2 antibody


Immunohistochemical staining using EIF4E2 antibody (70R-1416)

EIF4E2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EIF4E2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF4E2 belongs to the eukaryotic initiation factor 4E family. It recognises and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using EIF4E2 antibody (70R-1416) | EIF4E2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using EIF4E2 antibody (70R-1416) | EIF4E2 antibody (70R-1416) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors