EIF4H antibody (70R-4728)

Rabbit polyclonal EIF4H antibody raised against the C terminal of EIF4H

Synonyms Polyclonal EIF4H antibody, Anti-EIF4H antibody, EIFH 4 antibody, Eukaryotic Translation Initiation Factor 4H antibody, WBSCR1 antibody, EIFH-4 antibody, KIAA0038 antibody, EIF4H, WSCR1 antibody, EIFH 4, EIFH-4
Specificity EIF4H antibody was raised against the C terminal of EIF4H
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EIF4H antibody was raised using the C terminal of EIF4H corresponding to a region with amino acids TEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE
Assay Information EIF4H Blocking Peptide, catalog no. 33R-9032, is also available for use as a blocking control in assays to test for specificity of this EIF4H antibody


Western Blot analysis using EIF4H antibody (70R-4728)

EIF4H antibody (70R-4728) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF4H antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF4H is one of the translation initiation factors, which functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EIF4H antibody (70R-4728) | EIF4H antibody (70R-4728) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors