ELAC1 antibody (70R-3181)

Rabbit polyclonal ELAC1 antibody

Synonyms Polyclonal ELAC1 antibody, Anti-ELAC1 antibody, D29 antibody, Elac Homolog 1 antibody
Cross Reactivity Human
Applications WB
Immunogen ELAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFHRIPSFGFSVVEKKRPGKLNAQKLKDLGVPPGPAYGKLKNGISVVLEN
Assay Information ELAC1 Blocking Peptide, catalog no. 33R-4938, is also available for use as a blocking control in assays to test for specificity of this ELAC1 antibody

Images

Western Blot analysis using ELAC1 antibody (70R-3181)

ELAC1 antibody (70R-3181) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ELAC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ELAC1 belongs to the RNase Z family. It is a zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. The protein is probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ELAC1 antibody (70R-3181) | ELAC1 antibody (70R-3181) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors