Elastase 1 antibody (Pancreatic) (70R-4123)

Rabbit polyclonal Elastase 1 antibody (Pancreatic) raised against the N terminal of ELA1

Synonyms Polyclonal Elastase 1 antibody (Pancreatic), Anti-Elastase 1 antibody (Pancreatic), Elastase 1 Pancreatic antibody, ELA1 antibody
Specificity Elastase 1 antibody (Pancreatic) was raised against the N terminal of ELA1
Cross Reactivity Human
Applications WB
Immunogen Elastase 1 antibody (Pancreatic) was raised using the N terminal of ELA1 corresponding to a region with amino acids LVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGT
Assay Information Elastase 1 Blocking Peptide (Pancreatic), catalog no. 33R-5528, is also available for use as a blocking control in assays to test for specificity of this Elastase 1 antibody (Pancreatic)

Images

Western Blot analysis using Elastase 1 antibody (Pancreatic) (70R-4123)

Elastase 1 antibody (Pancreatic) (70R-4123) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ELA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 (ELA1) expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas is actually referring to elastase 2A.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Elastase 1 antibody (Pancreatic) (70R-4123) | Elastase 1 antibody (Pancreatic) (70R-4123) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors