ELAVL2 antibody (70R-4835)

Rabbit polyclonal ELAVL2 antibody raised against the N terminal of ELAVL2

Synonyms Polyclonal ELAVL2 antibody, Anti-ELAVL2 antibody, HEL-N1 antibody, Elav antibody, HELN1 antibody, HUB antibody
Specificity ELAVL2 antibody was raised against the N terminal of ELAVL2
Cross Reactivity Human
Applications WB
Immunogen ELAVL2 antibody was raised using the N terminal of ELAVL2 corresponding to a region with amino acids METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNLIVNYLPQNM
Assay Information ELAVL2 Blocking Peptide, catalog no. 33R-5974, is also available for use as a blocking control in assays to test for specificity of this ELAVL2 antibody


Western Blot analysis using ELAVL2 antibody (70R-4835)

ELAVL2 antibody (70R-4835) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ELAVL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a neural-specific RNA-binding protein that is known to bind to several 3' UTRs, including its own and also that of FOS and ID. The encoded protein may recognise a GAAA motif in the RNA. Three transcript variants encoding two different isoforms have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ELAVL2 antibody (70R-4835) | ELAVL2 antibody (70R-4835) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors