ELAVL4 Blocking Peptide (33R-6346)
A synthetic peptide for use as a blocking control in assays to test for specificity of ELAVL4 antibody, catalog no. 70R-4836
Overview
Overview
| Synonyms | ELAVL4 control peptide, ELAVL4 antibody Blocking Peptide, Anti-ELAVL4 Blocking Peptide, Elav Blocking Peptide, HUD Blocking Peptide, PNEM Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG |
|---|---|
| Molecular Weight | 42 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ELAVL4 may play a role in neuron-specific RNA processing. ELAVL4 protects CDKN1A mRNA from decay by binding to its 3'-UTR By similarity. ELAVL4 binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product