ELAVL4 Blocking Peptide (33R-6346)

A synthetic peptide for use as a blocking control in assays to test for specificity of ELAVL4 antibody, catalog no. 70R-4836

Synonyms ELAVL4 control peptide, ELAVL4 antibody Blocking Peptide, Anti-ELAVL4 Blocking Peptide, Elav Blocking Peptide, HUD Blocking Peptide, PNEM Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG
Molecular Weight 42 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ELAVL4 may play a role in neuron-specific RNA processing. ELAVL4 protects CDKN1A mRNA from decay by binding to its 3'-UTR By similarity. ELAVL4 binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors