ELMO1 Blocking Peptide (33R-9254)

A synthetic peptide for use as a blocking control in assays to test for specificity of ELMO1 antibody, catalog no. 70R-9836

Synonyms ELMO1 control peptide, ELMO1 antibody Blocking Peptide, Anti-ELMO1 Blocking Peptide, engulfment and cell motility 1 Blocking Peptide, CED-12 Blocking Peptide, CED12 Blocking Peptide, ELMO-1 Blocking Peptide, KIAA0281 Blocking Peptide, MGC126406 Blocking Peptide, ELMO1, ELMO-1, ELMO 1, ELMO-1 Blocking Peptide, ELMO 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIELT
Molecular Weight 84 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene interacts with the dedicator of cyto-kinesis 1 protein to promote phagocytosis and effect cell shape changes. Similarity to a C. elegans protein suggests that this protein may function in apoptosis and in cell migration. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors