ELMO1 Blocking Peptide (33R-9254)
A synthetic peptide for use as a blocking control in assays to test for specificity of ELMO1 antibody, catalog no. 70R-9836
Overview
Overview
| Synonyms | ELMO1 control peptide, ELMO1 antibody Blocking Peptide, Anti-ELMO1 Blocking Peptide, engulfment and cell motility 1 Blocking Peptide, CED-12 Blocking Peptide, CED12 Blocking Peptide, ELMO-1 Blocking Peptide, KIAA0281 Blocking Peptide, MGC126406 Blocking Peptide, ELMO1, ELMO-1, ELMO 1, ELMO-1 Blocking Peptide, ELMO 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIELT |
|---|---|
| Molecular Weight | 84 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene interacts with the dedicator of cyto-kinesis 1 protein to promote phagocytosis and effect cell shape changes. Similarity to a C. elegans protein suggests that this protein may function in apoptosis and in cell migration. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product