EME1 antibody (70R-3166)

Rabbit polyclonal EME1 antibody

Synonyms Polyclonal EME1 antibody, Anti-EME1 antibody, MMS4L antibody, EME-1 antibody, EME 1 antibody, EME-1, EME1, Essential Meiotic Endonuclease 1 Homolog 1 antibody, EME 1, FLJ31364 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR
Assay Information EME1 Blocking Peptide, catalog no. 33R-1632, is also available for use as a blocking control in assays to test for specificity of this EME1 antibody


Western Blot analysis using EME1 antibody (70R-3166)

EME1 antibody (70R-3166) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EME1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EME1 interacts with MUS81 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. EME1 may be required in mitosis for the processing of stalled or collapsed replication forks.EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EME1 antibody (70R-3166) | EME1 antibody (70R-3166) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors