EME1 antibody (70R-3188)

Rabbit polyclonal EME1 antibody

Synonyms Polyclonal EME1 antibody, Anti-EME1 antibody, FLJ31364 antibody, EME1, EME-1, Essential Meiotic Endonuclease 1 Homolog 1 antibody, MMS4L antibody, EME 1 antibody, EME-1 antibody, EME 1
Cross Reactivity Human,Mouse
Applications WB
Immunogen EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDIS
Assay Information EME1 Blocking Peptide, catalog no. 33R-5688, is also available for use as a blocking control in assays to test for specificity of this EME1 antibody


Western Blot analysis using EME1 antibody (70R-3188)

EME1 antibody (70R-3188) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EME1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EME1 antibody (70R-3188) | EME1 antibody (70R-3188) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors