Endoglin antibody (70R-1692)

Rabbit polyclonal Endoglin antibody

Synonyms Polyclonal Endoglin antibody, Anti-Endoglin antibody, ENG antibody, Osler-Rendu-Weber Syndrome 1 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen Endoglin antibody was raised using a synthetic peptide corresponding to a region with amino acids GLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQLDSCHLDLGPEGG
Assay Information Endoglin Blocking Peptide, catalog no. 33R-3432, is also available for use as a blocking control in assays to test for specificity of this Endoglin antibody


Western Blot analysis using Endoglin antibody (70R-1692)

Endoglin antibody (70R-1692) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ENG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Endoglin is a homodimeric transmembrane glycoprotein highly expressed by endothelial cells. It is a component of the transforming growth factor beta receptor complex as it binds TGFB1 and TGFB3 with high affinity. Mutations in the endoglin gene produce hereditary hemorrhagic telangiectasia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Endoglin antibody (70R-1692) | Endoglin antibody (70R-1692) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors