Enolase 3 antibody (70R-2263)

Rabbit polyclonal Enolase 3 antibody

Synonyms Polyclonal Enolase 3 antibody, Anti-Enolase 3 antibody, ENO3 antibody, MSE antibody
Cross Reactivity Human
Applications WB
Immunogen Enolase 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN
Assay Information Enolase 3 Blocking Peptide, catalog no. 33R-2776, is also available for use as a blocking control in assays to test for specificity of this Enolase 3 antibody


Immunohistochemical staining using Enolase 3 antibody (70R-2263)

Enolase 3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ENO3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ENO3 is one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in ENO3 gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using Enolase 3 antibody (70R-2263) | Enolase 3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using Enolase 3 antibody (70R-2263) | Enolase 3 antibody (70R-2263) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors