Eph Receptor A5 antibody (70R-2219)

Rabbit polyclonal Eph Receptor A5 antibody raised against the middle region of EPHA5

Synonyms Polyclonal Eph Receptor A5 antibody, Anti-Eph Receptor A5 antibody, EPHA5 antibody, EPHA 5 antibody, EPHA-5 antibody, CEK7 antibody, TYRO4 antibody, EPHA 5, HEK7 antibody, EPHA-5, EHK1 antibody, EPHA5
Specificity Eph Receptor A5 antibody was raised against the middle region of EPHA5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Eph Receptor A5 antibody was raised using the middle region of EPHA5 corresponding to a region with amino acids SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP
Assay Information Eph Receptor A5 Blocking Peptide, catalog no. 33R-8364, is also available for use as a blocking control in assays to test for specificity of this Eph Receptor A5 antibody


Western Blot analysis using Eph Receptor A5 antibody (70R-2219)

Eph Receptor A5 antibody (70R-2219) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 114 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPHA5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EPHA5 belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Eph Receptor A5 antibody (70R-2219) | Eph Receptor A5 antibody (70R-2219) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors