EPHX1 Blocking Peptide (33R-1773)
A synthetic peptide for use as a blocking control in assays to test for specificity of EPHX1 antibody, catalog no. 70R-5355
Overview
Overview
| Synonyms | EPHX1 control peptide, EPHX1 antibody Blocking Peptide, Anti-EPHX1 Blocking Peptide, Epoxide Hydrolase 1 Microsomal Blocking Peptide, EPHX Blocking Peptide, EPOX Blocking Peptide, MEH Blocking Peptide, EPHX1, EPHX-1, EPHX 1, EPHX-1 Blocking Peptide, EPHX 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI |
|---|---|
| Molecular Weight | 53 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product