EPHX1 Blocking Peptide (33R-3472)

A synthetic peptide for use as a blocking control in assays to test for specificity of EPHX1 antibody, catalog no. 70R-5354

Synonyms EPHX1 control peptide, EPHX1 antibody Blocking Peptide, Anti-EPHX1 Blocking Peptide, Epoxide Hydrolase 1 Microsomal Blocking Peptide, EPHX Blocking Peptide, EPOX Blocking Peptide, MEH Blocking Peptide, EPHX1, EPHX-1, EPHX 1, EPHX-1 Blocking Peptide, EPHX 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues GPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYG
Molecular Weight 53 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors