ERCC6L antibody (70R-3241)

Rabbit polyclonal ERCC6L antibody raised against the N terminal Of Ercc6L

Synonyms Polyclonal ERCC6L antibody, Anti-ERCC6L antibody, PICH antibody, FLJ20105 antibody, MGC131695 antibody
Specificity ERCC6L antibody was raised against the N terminal Of Ercc6L
Cross Reactivity Human
Applications WB
Immunogen ERCC6L antibody was raised using the N terminal Of Ercc6L corresponding to a region with amino acids GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS
Assay Information ERCC6L Blocking Peptide, catalog no. 33R-3202, is also available for use as a blocking control in assays to test for specificity of this ERCC6L antibody


Western Blot analysis using ERCC6L antibody (70R-3241)

ERCC6L antibody (70R-3241) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 141 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERCC6L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ERCC6L is a DNA helicase that acts as an essential component of the spindle assembly checkpoint.ERCC6L contributes to the mitotic checkpoint by recruiting MAD2 to kinetochores and monitoring tension on centromeric chromatin. ERCC6L acts as a tension sensor that associates with catenated DNA which is stretched under tension until it is resolved during anaphase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ERCC6L antibody (70R-3241) | ERCC6L antibody (70R-3241) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors