ERCC8 antibody (70R-2728)

Rabbit polyclonal ERCC8 antibody raised against the middle region of ERCC8

Synonyms Polyclonal ERCC8 antibody, Anti-ERCC8 antibody, Excision Repair Cross-Complementing Rodent Repair Deficiency Complementation Group 8 antibody, CSA antibody, CKN1 antibody
Specificity ERCC8 antibody was raised against the middle region of ERCC8
Cross Reactivity Human
Applications WB
Immunogen ERCC8 antibody was raised using the middle region of ERCC8 corresponding to a region with amino acids FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE
Assay Information ERCC8 Blocking Peptide, catalog no. 33R-3030, is also available for use as a blocking control in assays to test for specificity of this ERCC8 antibody

Images

Western blot analysis using ERCC8 antibody (70R-2728)

Recommended ERCC8 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERCC8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ERCC8 is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using ERCC8 antibody (70R-2728) | Recommended ERCC8 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors