ERVWE1 Blocking Peptide (33R-9252)

A synthetic peptide for use as a blocking control in assays to test for specificity of ERVWE1 antibody, catalog no. 70R-6947

Synonyms ERVWE1 control peptide, ERVWE1 antibody Blocking Peptide, Anti-ERVWE1 Blocking Peptide, Endogenous Retroviral Family W Env Blocking Peptide, C7 Member 1 Blocking Peptide, Env-W Blocking Peptide, HERV-7q Blocking Peptide, HERV-W Blocking Peptide, HERV-W-ENV Blocking Peptide, HERVW Blocking Peptide, env Blocking Peptide, syncytin Blocking Peptide, ERVWE1, ERVWE-1, ERVWE 1, ERVWE-1 Blocking Peptide, ERVWE 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLR
Molecular Weight 24 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ERVWE1 or syncytin, is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors