ESRRA Blocking Peptide (33R-4336)
A synthetic peptide for use as a blocking control in assays to test for specificity of ESRRA antibody, catalog no. 70R-1924
Overview
Overview
| Synonyms | ESRRA control peptide, ESRRA antibody Blocking Peptide, Anti-ESRRA Blocking Peptide, Estrogen-Related Receptor Alpha Blocking Peptide, ERR1 Blocking Peptide, ERRa Blocking Peptide, ERRalpha Blocking Peptide, ESRL1 Blocking Peptide, NR3B1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN |
|---|---|
| Molecular Weight | 46 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ESRRA is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product