ESRRA Blocking Peptide (33R-4336)

A synthetic peptide for use as a blocking control in assays to test for specificity of ESRRA antibody, catalog no. 70R-1924

Synonyms ESRRA control peptide, ESRRA antibody Blocking Peptide, Anti-ESRRA Blocking Peptide, Estrogen-Related Receptor Alpha Blocking Peptide, ERR1 Blocking Peptide, ERRa Blocking Peptide, ERRalpha Blocking Peptide, ESRL1 Blocking Peptide, NR3B1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN
Molecular Weight 46 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ESRRA is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors