ESRRG Blocking Peptide (33R-2143)

A synthetic peptide for use as a blocking control in assays to test for specificity of ESRRG antibody, catalog no. 70R-1940

Synonyms ESRRG control peptide, ESRRG antibody Blocking Peptide, Anti-ESRRG Blocking Peptide, Estrogen-Related Receptor Gamma Blocking Peptide, DKFZp781L1617 Blocking Peptide, ERR3 Blocking Peptide, FLJ16023 Blocking Peptide, KIAA0832 Blocking Peptide, NR3B3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN
Molecular Weight 51 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors