ESRRG Blocking Peptide (33R-2143)
A synthetic peptide for use as a blocking control in assays to test for specificity of ESRRG antibody, catalog no. 70R-1940
Overview
Overview
| Synonyms | ESRRG control peptide, ESRRG antibody Blocking Peptide, Anti-ESRRG Blocking Peptide, Estrogen-Related Receptor Gamma Blocking Peptide, DKFZp781L1617 Blocking Peptide, ERR3 Blocking Peptide, FLJ16023 Blocking Peptide, KIAA0832 Blocking Peptide, NR3B3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN |
|---|---|
| Molecular Weight | 51 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product