Estrogen Receptor 1 Blocking Peptide (33R-5132)
A synthetic peptide for use as a blocking control in assays to test for specificity of ESR1 antibody, catalog no. 70R-5681
Overview
Overview
| Synonyms | Estrogen Receptor 1 control peptide, Estrogen Receptor 1 antibody Blocking Peptide, Anti-Estrogen Receptor 1 Blocking Peptide, DKFZp686N23123 Blocking Peptide, ER Blocking Peptide, ESR Blocking Peptide, ESRA Blocking Peptide, Era Blocking Peptide, NR3A1 Blocking Peptide, ESR1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | LLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAE |
|---|---|
| Molecular Weight | 66 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product