Estrogen Receptor 1 Blocking Peptide (33R-5132)

A synthetic peptide for use as a blocking control in assays to test for specificity of ESR1 antibody, catalog no. 70R-5681

Synonyms Estrogen Receptor 1 control peptide, Estrogen Receptor 1 antibody Blocking Peptide, Anti-Estrogen Receptor 1 Blocking Peptide, DKFZp686N23123 Blocking Peptide, ER Blocking Peptide, ESR Blocking Peptide, ESRA Blocking Peptide, Era Blocking Peptide, NR3A1 Blocking Peptide, ESR1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAE
Molecular Weight 66 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors