ETF1 antibody (70R-3656)

Rabbit polyclonal ETF1 antibody raised against the N terminal of ETF1

Synonyms Polyclonal ETF1 antibody, Anti-ETF1 antibody, D5S1995 antibody, MGC111066 antibody, SUP45L1 antibody, ERF antibody, ERF1 antibody, Eukaryotic Translation Termination Factor 1 antibody, TB3-1 antibody, RF1 antibody
Specificity ETF1 antibody was raised against the N terminal of ETF1
Cross Reactivity Human
Applications WB
Immunogen ETF1 antibody was raised using the N terminal of ETF1 corresponding to a region with amino acids ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL
Assay Information ETF1 Blocking Peptide, catalog no. 33R-4157, is also available for use as a blocking control in assays to test for specificity of this ETF1 antibody


Western Blot analysis using ETF1 antibody (70R-3656)

ETF1 antibody (70R-3656) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ETF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ETF1 antibody (70R-3656) | ETF1 antibody (70R-3656) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors