EVE antibody (70R-2549)

Rabbit polyclonal EVE antibody raised against the N terminal Of Eve

Synonyms Polyclonal EVE antibody, Anti-EVE antibody, 10.5 antibody, eve2 antibody, 14.10 antibody, CG2328 antibody, unnamed antibody, Dmel_CG2328 antibody, l(2)46Ce antibody, V antibody, 10.9 antibody, E(eve) antibody, EVE antibody, 20.35 antibody, F antibody, VI antibody
Specificity EVE antibody was raised against the N terminal Of Eve
Cross Reactivity Drosophila
Applications WB
Immunogen EVE antibody was raised using the N terminal Of Eve corresponding to a region with amino acids MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS
Assay Information EVE Blocking Peptide, catalog no. 33R-6092, is also available for use as a blocking control in assays to test for specificity of this EVE antibody


Western blot analysis using EVE antibody (70R-2549)

Recommended eve Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EVE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Eve may play a role in determining neuronal identity. It may be directly involved in specifying identity of individual neurons. It is a pair-rule protein required for segmentation; involved in transforming the broad, spatial, aperiodic expression patterns of the gap genes into a system of precise periodic expression patterns of the pair-rule and segmentary polarity genes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using EVE antibody (70R-2549) | Recommended eve Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors