EXD antibody (70R-1246)
Rabbit polyclonal EXD antibody raised against the C terminal Of Exd
Overview
Overview
| Synonyms | Polyclonal EXD antibody, Anti-EXD antibody, td48 antibody, Dm-EXD antibody, DExd antibody, unnamed antibody, CG8933 antibody, EXD antibody, Dpbx antibody, Dmel_CG8933 antibody |
|---|---|
| Specificity | EXD antibody was raised against the C terminal Of Exd |
| Cross Reactivity | Drosophila,melanogaster |
| Applications | WB |
| Immunogen | EXD antibody was raised using the C terminal Of Exd corresponding to a region with amino acids EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA |
| Assay Information | EXD Blocking Peptide, catalog no. 33R-2263, is also available for use as a blocking control in assays to test for specificity of this EXD antibody |
Images
Western blot analysis using EXD antibody (70R-1246)
Recommended exd Antibody Titration: 5.0ug/ml
EXD antibody
Western blot analysis using EXD antibody (70R-1246)
Recommended exd Antibody Titration: 5.0ug/ml
Western blot analysis using EXD antibody (70R-1246)
Lane1: E. coli purified Exd (no tag) Lane2: Cell free expressed Exd (His tag) Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:5000
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Total IgG Protein A purified |
| Molecular Weight | 42 kDa (MW of target protein) |
| Form & Buffer | Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EXD antibody in PBS |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 5 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | As a transcription factor, exd acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless, teashirt and decapentaplegic. Thus exd affects segmental identity. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product
