EXD antibody (70R-1246)

Rabbit polyclonal EXD antibody raised against the C terminal Of Exd

Synonyms Polyclonal EXD antibody, Anti-EXD antibody, td48 antibody, Dm-EXD antibody, DExd antibody, unnamed antibody, CG8933 antibody, EXD antibody, Dpbx antibody, Dmel_CG8933 antibody
Specificity EXD antibody was raised against the C terminal Of Exd
Cross Reactivity Drosophila,melanogaster
Applications WB
Immunogen EXD antibody was raised using the C terminal Of Exd corresponding to a region with amino acids EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA
Assay Information EXD Blocking Peptide, catalog no. 33R-2263, is also available for use as a blocking control in assays to test for specificity of this EXD antibody


Western blot analysis using EXD antibody (70R-1246)

Recommended exd Antibody Titration: 5.0ug/ml


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EXD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance As a transcription factor, exd acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless, teashirt and decapentaplegic. Thus exd affects segmental identity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using EXD antibody (70R-1246) | Recommended exd Antibody Titration: 5.0ug/ml
  • Western blot analysis using EXD antibody (70R-1246) | Lane1: E. coli purified Exd (no tag) Lane2: Cell free expressed Exd (His tag) Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:5000

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors