This websites use cookies. By continuing to browse the site you are agreeing to our use of cookies.
United States ($)
United Kingdom (£)
Europe (€)
JavaScript seems to be disabled in your browser.
You must have JavaScript enabled in your browser to utilize the functionality of this website.
EXD antibody (70R-1246)
Rabbit polyclonal EXD antibody raised against the C terminal Of Exd
Synonyms
Polyclonal EXD antibody, Anti-EXD antibody, td48 antibody, Dm-EXD antibody, DExd antibody, unnamed antibody, CG8933 antibody, EXD antibody, Dpbx antibody, Dmel_CG8933 antibody
Specificity
EXD antibody was raised against the C terminal Of Exd
Cross Reactivity
Drosophila,melanogaster
Applications
WB
Immunogen
EXD antibody was raised using the C terminal Of Exd corresponding to a region with amino acids EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA
Assay Information
EXD Blocking Peptide, catalog no. 33R-2263, is also available for use as a blocking control in assays to test for specificity of this EXD antibody
Specifications
Host
Rabbit
Method of Purification
Total IgG Protein A purified
Molecular Weight
42 kDa (MW of target protein)
Form & Buffer
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EXD antibody in PBS
Concentration
1 mg/ml
Usage & Assay Information
Usage Recommendations
WB: 5 ug/ml
Storage & Safety
Storage
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
General Information
Biological Significance
As a transcription factor, exd acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless, teashirt and decapentaplegic. Thus exd affects segmental identity.
References
Add a Paper
Have you referenced this product?
Sorry, but there are no references currently for this product.
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product
Availability: In stock
Price:
€258.73
Size: 100 ug