EXOD1 antibody (70R-3112)

Rabbit polyclonal EXOD1 antibody raised against the N terminal Of Exod1

Synonyms Polyclonal EXOD1 antibody, Anti-EXOD1 antibody, KIAA1504 antibody, EXOD 1 antibody, EXOD-1 antibody, EXOD1, MGC16943 antibody, EXOD 1, EXOD-1
Specificity EXOD1 antibody was raised against the N terminal Of Exod1
Cross Reactivity Human
Applications WB
Immunogen EXOD1 antibody was raised using the N terminal Of Exod1 corresponding to a region with amino acids GQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKW
Assay Information EXOD1 Blocking Peptide, catalog no. 33R-3497, is also available for use as a blocking control in assays to test for specificity of this EXOD1 antibody


Western blot analysis using EXOD1 antibody (70R-3112)

Recommended EXOD1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EXOD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EXOD1 belongs to the EXOD1 family. It contains 1 exonuclease domain. EXOD1 is a member of a new subclass of exonucleases called the 3'hExo/ERI-1 subfamily of DEDDh nucleases.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using EXOD1 antibody (70R-3112) | Recommended EXOD1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors