EXOSC4 antibody (70R-1330)

Rabbit polyclonal EXOSC4 antibody raised against the N terminal of EXOSC4

Synonyms Polyclonal EXOSC4 antibody, Anti-EXOSC4 antibody, EXOSC4, EXOSC 4, Exosome Component 4 antibody, EXOSC-4 antibody, EXOSC 4 antibody, EXOSC-4
Specificity EXOSC4 antibody was raised against the N terminal of EXOSC4
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen EXOSC4 antibody was raised using the N terminal of EXOSC4 corresponding to a region with amino acids SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE
Assay Information EXOSC4 Blocking Peptide, catalog no. 33R-8366, is also available for use as a blocking control in assays to test for specificity of this EXOSC4 antibody

Images

Immunohistochemical staining using EXOSC4 antibody (70R-1330)

EXOSC4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EXOSC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EXOSC4 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. It has a 3'-5' exonuclease activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using EXOSC4 antibody (70R-1330) | EXOSC4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X.
  • Western Blot analysis using EXOSC4 antibody (70R-1330) | EXOSC4 antibody (70R-1330) used at 5 ug/ml to detect target protein.
  • Immunohistochemical staining using EXOSC4 antibody (70R-1330) | EXOSC4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors