EXOSC7 antibody (70R-1337)

Rabbit polyclonal EXOSC7 antibody raised against the N terminal of EXOSC7

Synonyms Polyclonal EXOSC7 antibody, Anti-EXOSC7 antibody, Exosome Component 7 antibody, EXOSC-7, EXOSC-7 antibody, EXOSC 7, EXOSC 7 antibody, EXOSC7
Specificity EXOSC7 antibody was raised against the N terminal of EXOSC7
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD
Assay Information EXOSC7 Blocking Peptide, catalog no. 33R-4910, is also available for use as a blocking control in assays to test for specificity of this EXOSC7 antibody


Immunohistochemical staining using EXOSC7 antibody (70R-1337)

EXOSC7 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EXOSC7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using EXOSC7 antibody (70R-1337) | EXOSC7 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using EXOSC7 antibody (70R-1337) | EXOSC7 antibody (70R-1337) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors