EXOSC7 antibody (70R-4747)

Rabbit polyclonal EXOSC7 antibody raised against the N terminal of EXOSC7

Synonyms Polyclonal EXOSC7 antibody, Anti-EXOSC7 antibody, hRrp42p antibody, EXOSC-7, Exosome Component 7 antibody, EXOSC 7, KIAA0116 antibody, EAP1 antibody, FLJ26543 antibody, EXOSC7, EXOSC 7 antibody, RRP42 antibody, EXOSC-7 antibody, p8 antibody, Rrp42p antibody
Specificity EXOSC7 antibody was raised against the N terminal of EXOSC7
Cross Reactivity Human,Mouse
Applications WB
Immunogen EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC
Assay Information EXOSC7 Blocking Peptide, catalog no. 33R-2780, is also available for use as a blocking control in assays to test for specificity of this EXOSC7 antibody


Western Blot analysis using EXOSC7 antibody (70R-4747)

EXOSC7 antibody (70R-4747) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EXOSC7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. The protein is required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EXOSC7 antibody (70R-4747) | EXOSC7 antibody (70R-4747) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors