EXT1 antibody (70R-5709)

Rabbit polyclonal EXT1 antibody

Synonyms Polyclonal EXT1 antibody, Anti-EXT1 antibody, EXT antibody, Exostoses 1 antibody, ttv antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EXT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAKASISTENFRPNFDVSIPLFSKDHPRTGGERGFLKFNTIPPLRKYMLV
Assay Information EXT1 Blocking Peptide, catalog no. 33R-4777, is also available for use as a blocking control in assays to test for specificity of this EXT1 antibody


Western Blot analysis using EXT1 antibody (70R-5709)

EXT1 antibody (70R-5709) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EXT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EXT1 is an endoplasmic reticulum-resident type II transmembrane glycosyltransferase involved in the chain elongation step of heparan sulfate biosynthesis. This gene encodes an endoplasmic reticulum-resident type II transmembrane glycosyltransferase involved in the chain elongation step of heparan sulfate biosynthesis. Mutations in this gene cause the type I form of multiple exostoses.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EXT1 antibody (70R-5709) | EXT1 antibody (70R-5709) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €309.90
Size: 50 ug
View Our Distributors