F7 Blocking Peptide (33R-1026)
A synthetic peptide for use as a blocking control in assays to test for specificity of F7 antibody, catalog no. 70R-9969
Overview
Overview
| Synonyms | F7 control peptide, F7 antibody Blocking Peptide, Anti-F7 Blocking Peptide, coagulation factor VII, serum prothrombin conversion accelerator Blocking Peptide, F7, F-7, F 7, F-7 Blocking Peptide, F 7 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAHCFDKIKNWRNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTN |
|---|---|
| Molecular Weight | 28 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes coagulation factor VII which is a vitamin K-dependent factor essential for hemostasis. This factor circulates in the blood in a zymogen form, and is converted to an active form by either factor IXa, factor Xa, factor XIIa, or thrombin by minor proteolysis. Upon activation of the factor VII, a heavy chain containing a catalytic domain and a light chain containing 2 EGF-like domains are generated, and two chains are held together by a disulfide bond. In the presence of factor III and calcium ions, the activated factor then further activates the coagulation cascade by converting factor IX to factor IXa and/or factor X to factor Xa. Alternative splicing of this gene results in 2 transcripts. Defects in this gene can cause coagulopathy. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product