FAM107A antibody (70R-1070)

Rabbit polyclonal FAM107A antibody raised against the middle region of FAM107A

Synonyms Polyclonal FAM107A antibody, Anti-FAM107A antibody, FAM-107, FLJ45473 antibody, FAM 107 antibody, FAM 107, TU3A antibody, FLJ30158 antibody, FAM107, FAM-107 antibody, Family With Sequence Similarity 107 Member A antibody, DRR1 antibody
Specificity FAM107A antibody was raised against the middle region of FAM107A
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen FAM107A antibody was raised using the middle region of FAM107A corresponding to a region with amino acids RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE
Assay Information FAM107A Blocking Peptide, catalog no. 33R-8045, is also available for use as a blocking control in assays to test for specificity of this FAM107A antibody


Western Blot analysis using FAM107A antibody (70R-1070)

FAM107A antibody (70R-1070) used at 0.0625 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FAM107A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.0625 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM107A antibody (70R-1070) | FAM107A antibody (70R-1070) used at 0.0625 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors