FAM119A antibody (70R-3148)

Rabbit polyclonal FAM119A antibody raised against the middle region of FAM119A

Synonyms Polyclonal FAM119A antibody, Anti-FAM119A antibody, MGC45373 antibody, FAM-119, FAM 119, Family With Sequence Similarity 119 Member A antibody, FAM-119 antibody, FAM 119 antibody, FAM119
Specificity FAM119A antibody was raised against the middle region of FAM119A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM119A antibody was raised using the middle region of FAM119A corresponding to a region with amino acids LGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVK
Assay Information FAM119A Blocking Peptide, catalog no. 33R-4961, is also available for use as a blocking control in assays to test for specificity of this FAM119A antibody

Images

Western Blot analysis using FAM119A antibody (70R-3148)

FAM119A antibody (70R-3148) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM119A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM119A is a multi-pass membrane protein. It belongs to the FAM119 family. The function of the FAM119A protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM119A antibody (70R-3148) | FAM119A antibody (70R-3148) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors