FAM129A antibody (70R-1294)

Rabbit polyclonal FAM129A antibody raised against the N terminal of FAM129A

Synonyms Polyclonal FAM129A antibody, Anti-FAM129A antibody, FAM-129, Family With Sequence Similarity 129 Member A antibody, FAM-129 antibody, FAM129, FAM 129 antibody, FLJ38228 antibody, FAM 129, NIBAN antibody, C1orf24 antibody
Specificity FAM129A antibody was raised against the N terminal of FAM129A
Cross Reactivity Human
Applications WB
Immunogen FAM129A antibody was raised using the N terminal of FAM129A corresponding to a region with amino acids SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKE
Assay Information FAM129A Blocking Peptide, catalog no. 33R-8947, is also available for use as a blocking control in assays to test for specificity of this FAM129A antibody


Western Blot analysis using FAM129A antibody (70R-1294)

FAM129A antibody (70R-1294) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 103 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FAM129A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM129A is expressed in subsets of thyroid tumors and Hashimoto's thyroiditis and it is a novel tumor marker.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM129A antibody (70R-1294) | FAM129A antibody (70R-1294) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors